Protein Info for IAI46_10385 in Serratia liquefaciens MT49

Annotation: cupin domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 PF08007: JmjC_2" amino acids 96 to 210 (115 residues), 135.3 bits, see alignment E=9.1e-44 PF20514: ROXA-like_wH" amino acids 257 to 370 (114 residues), 94.1 bits, see alignment E=6.2e-31

Best Hits

Swiss-Prot: 78% identical to ROXA_ECOLI: 50S ribosomal protein L16 3-hydroxylase (roxA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 94% identity to spe:Spro_2011)

MetaCyc: 78% identical to 50S ribosomal protein L16-arginine 3-hydroxylase (Escherichia coli K-12 substr. MG1655)
RXN0-7090 [EC: 1.14.11.47]

Predicted SEED Role

"FIG002776: hypothetical protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.11.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (373 amino acids)

>IAI46_10385 cupin domain-containing protein (Serratia liquefaciens MT49)
MDYQLDLDWNDFLQRYWQKRPVILKRGFKNFIDPISPDELAGLAMENEVDSRLVSHQDGR
WQVAHGPFESFDHLSENNWSLLVQAVDHWHEPSSALMLPFRKLPDWRMDDLMISFSVPGG
GVGPHLDQYDVFIIQGTGRRRWRVGEKVPMKQHCPHPDLLQVEPFDAIIDEEMEPGDILY
IPPGFPHEGYALENALNYSVGFRAPNGRELVSGFADYVLARELGSKRYSDPDIQLREHPA
EVLPHEVDALRQMMVDLVQQPEHFQQWFGEFISQTRHELDAAPPEPPYQAGEIYELLQQG
EPLQRLGGLRVLRIGDQCFANGELMDTEHQQAADAMCQNFSVDAAKLGDAIEDPSFLALL
TSLVNSGYWYFKD