Protein Info for IAI46_10365 in Serratia liquefaciens MT49

Annotation: glycoside hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 PF02056: Glyco_hydro_4" amino acids 2 to 181 (180 residues), 117.1 bits, see alignment E=7.2e-38 PF11975: Glyco_hydro_4C" amino acids 192 to 436 (245 residues), 151.1 bits, see alignment E=4.5e-48

Best Hits

KEGG orthology group: None (inferred from 95% identity to srr:SerAS9_1958)

Predicted SEED Role

"Maltose-6'-phosphate glucosidase (EC 3.2.1.122)" in subsystem Maltose and Maltodextrin Utilization or Trehalose Uptake and Utilization (EC 3.2.1.122)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.1.122

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (461 amino acids)

>IAI46_10365 glycoside hydrolase (Serratia liquefaciens MT49)
MKLTVLGGGGVRSPFLAKSIAYNAHRIGVTEVVFMDTDREKLAVYGAIAQGVFERIRSDI
RFSLSSDAHQALSGADYIITTLRIGGEEGRIHDERIALNHQVLGQETTGAGGFAMAMRSI
PAIVEYCRLIEQVSSPDAVLFNFTNPSGMVTEAIIKSGFKRKVYGICDAPSEFIRELAEL
LGCRESELSVDCFGLNHLSWFRNVRVNGQEVSEQLLADPRLYRDTCMKYFSPELVALSDN
LMLNEYLYYYYYREQAIAAIVDAGETRGEQIALINQQMLADLARLDIATQLDQAFSVYFA
HYLTRENSYMQRESSQGKVKEREMLTLQQFIEQPDSGGYAGVAIDILEAVNNGQQKRVVV
SMQNNGTLDFLHPEDVIEISCELSNAGIHPVKMNDIPDTQKNLISQVKEYERLAVAAILE
GDRQKAIKALMVHPLVNSYSLAKTLVEEYLQAHHQYAKHWH