Protein Info for IAI46_10355 in Serratia liquefaciens MT49

Annotation: NAD-dependent protein deacylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02146: SIR2
  • amino acids 46 to 219 (174 residues), 173.6 bits, E=2.1e-55

Best Hits

Swiss-Prot: 82% identical to NPD_YERPS: NAD-dependent protein deacylase (cobB) from Yersinia pseudotuberculosis serotype I (strain IP32953)

KEGG orthology group: K12410, NAD-dependent deacetylase [EC: 3.5.1.-] (inferred from 97% identity to srs:SerAS12_1956)

Predicted SEED Role

"NAD-dependent protein deacetylase of SIR2 family" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate or Redox-dependent regulation of nucleus processes

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Caprolactam degradation
• Glutathione metabolism
• Lipopolysaccharide biosynthesis
• Lysine biosynthesis
• Nicotinate and nicotinamide metabolism
• Nucleotide sugars metabolism
• Sphingolipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.-

Use Curated BLAST to search for 3.5.1.-

Protein Sequence (278 amino acids)

>IAI46_10355 NAD-dependent protein deacylase (Serratia liquefaciens MT49)
MHTRHRLCQFRKSKHVLHQRFRSRIFHRDTMAAAELKKPFVVVLTGAGISAESGIRTFRA
ADGLWEEHSVEDVATPEGYQRDPQLVQAFYNERRRQLQSSDIAPNAAHRALADLEAWLGD
NFLLVTQNIDNLHERAGSSRVLHMHGELLKVRCTSSGQVFDWPEDLSVDDRCHCCQFPAP
LRPHVVWFGEMPLGMDEIYQALAKADFFVAIGTSGHVYPAAGFVHEARLGGAHTMELNLE
PSQVESQFDEKHYGQASAVVPRFVHKFLVGKVERADRP