Protein Info for IAI46_10340 in Serratia liquefaciens MT49

Annotation: lipoprotein-releasing ABC transporter ATP-binding protein LolD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 TIGR02211: lipoprotein releasing system, ATP-binding protein" amino acids 6 to 225 (220 residues), 358.6 bits, see alignment E=5.9e-112 PF00005: ABC_tran" amino acids 26 to 174 (149 residues), 131 bits, see alignment E=5.1e-42

Best Hits

Swiss-Prot: 88% identical to LOLD_YERPS: Lipoprotein-releasing system ATP-binding protein LolD (lolD) from Yersinia pseudotuberculosis serotype I (strain IP32953)

KEGG orthology group: None (inferred from 98% identity to srr:SerAS9_1953)

MetaCyc: 80% identical to lipoprotein release complex - ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427

Predicted SEED Role

"Lipoprotein releasing system ATP-binding protein LolD"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (234 amino acids)

>IAI46_10340 lipoprotein-releasing ABC transporter ATP-binding protein LolD (Serratia liquefaciens MT49)
MSNHLLLQCDNLCKTYQEGNLHTDVLRNVSFAMQPGEMMAIVGSSGSGKSTLLHLLGGLD
SPTSGEVIYKGQSLNTLSSAAKAELRNRQLGFIYQFHHLLPDFTALENAAMPLLIGGMKP
AQAQEKALEMLTAVGLAKRSKHRPSELSGGERQRVAIARALVNNPSLVLADEPTGNLDKR
TADSIFDLLGELNVRQGTAFLVVTHDLQLAKRLSRQLEMADGHLQAQLTLLGAE