Protein Info for IAI46_10315 in Serratia liquefaciens MT49

Annotation: GGDEF domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 transmembrane" amino acids 9 to 28 (20 residues), see Phobius details amino acids 40 to 58 (19 residues), see Phobius details amino acids 70 to 123 (54 residues), see Phobius details amino acids 130 to 149 (20 residues), see Phobius details amino acids 160 to 179 (20 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 192 to 350 (159 residues), 137.8 bits, see alignment E=1.4e-44 PF00990: GGDEF" amino acids 194 to 347 (154 residues), 135.8 bits, see alignment E=6.2e-44

Best Hits

KEGG orthology group: None (inferred from 86% identity to spe:Spro_1997)

Predicted SEED Role

"Putative Heme-regulated two-component response regulator" in subsystem Putative hemin transporter or cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (366 amino acids)

>IAI46_10315 GGDEF domain-containing protein (Serratia liquefaciens MT49)
MTYVASIPTLYSDACITYATLSVSYFALSKNAPFSYQSEGWRRIVFGLLAGLAVLFLNQD
RLELSGNLHFSFAMIPMILVTFYGGAVSGLVCYLMSLAFTGGLTVDNLFIGSIIIPLLLS
RVWLRKSNRVFYLTIGIIALYRIGVVWLLADIRALWGDVLLYQAVSALCLAICFHGLNFK
ERHIHAYFSMRDKATTDSLTHINNRASVDYRLIQQQAERRPCGLMILDLDNFKRINDTYG
HLAGDLLLARVGQLLQSSVRSEDFVGRYGGEEFIVITASYDPTVIGGVAERIRRSVETTL
FLLDEGVEARITVSIGASLYLPGMALDKAIEVTDEALYDAKRQGKNRVVCSRLMQLAPLG
AGFRQE