Protein Info for IAI46_10290 in Serratia liquefaciens MT49

Annotation: SirB2 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 132 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 49 to 68 (20 residues), see Phobius details amino acids 75 to 93 (19 residues), see Phobius details amino acids 105 to 126 (22 residues), see Phobius details PF04247: SirB" amino acids 4 to 125 (122 residues), 143.9 bits, see alignment E=1.3e-46

Best Hits

Swiss-Prot: 52% identical to SIRB2_SALTI: Protein SirB2 (sirB2) from Salmonella typhi

KEGG orthology group: None (inferred from 96% identity to spe:Spro_1992)

Predicted SEED Role

"FIG002082: Protein SirB2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (132 amino acids)

>IAI46_10290 SirB2 family protein (Serratia liquefaciens MT49)
MAVYSALKHLHLLTVTISIVLFVLRFFWKWRNSAMMNKRWVKITPHINDTVLFVSGIALV
VMFKLYPLLGMDSWLTEKLFGVIIYILLGYVALGKKTKNQNLRTLAFVLALGCLYLIIKL
ATTKIPFLMGYL