Protein Info for IAI46_10285 in Serratia liquefaciens MT49

Annotation: peptide chain release factor N(5)-glutamine methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 TIGR00536: methyltransferase, HemK family" amino acids 1 to 276 (276 residues), 297.7 bits, see alignment E=7.4e-93 PF17827: PrmC_N" amino acids 6 to 73 (68 residues), 71 bits, see alignment E=4.4e-23 TIGR03534: protein-(glutamine-N5) methyltransferase, release factor-specific" amino acids 23 to 271 (249 residues), 301 bits, see alignment E=6.7e-94 PF06325: PrmA" amino acids 102 to 160 (59 residues), 24.6 bits, see alignment E=7.4e-09 PF05175: MTS" amino acids 103 to 190 (88 residues), 53.3 bits, see alignment E=1.2e-17 PF13847: Methyltransf_31" amino acids 109 to 240 (132 residues), 61.5 bits, see alignment E=3.6e-20 PF13649: Methyltransf_25" amino acids 113 to 183 (71 residues), 46.1 bits, see alignment E=3.1e-15 PF08241: Methyltransf_11" amino acids 114 to 183 (70 residues), 32.6 bits, see alignment E=4.8e-11 PF08242: Methyltransf_12" amino acids 114 to 165 (52 residues), 30.3 bits, see alignment 2.5e-10 PF01170: UPF0020" amino acids 128 to 190 (63 residues), 23.9 bits, see alignment E=1.4e-08

Best Hits

Swiss-Prot: 69% identical to PRMC_YERPE: Release factor glutamine methyltransferase (prmC) from Yersinia pestis

KEGG orthology group: None (inferred from 93% identity to srr:SerAS9_1943)

MetaCyc: 64% identical to protein-(glutamine-N5) methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-14992 [EC: 2.1.1.297]

Predicted SEED Role

"Protein-N(5)-glutamine methyltransferase PrmC, methylates polypeptide chain release factors RF1 and RF2"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.297

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (290 amino acids)

>IAI46_10285 peptide chain release factor N(5)-glutamine methyltransferase (Serratia liquefaciens MT49)
MDYQSWLKAAVARLTQSESARRDAEILLGFVTGRARTFLMAFGETVLTPQEQEQLERLLA
RRERGEPVAYLIGEREFWSLPLSVSPATLIPRPDTECLVELALELLPSSPCAILDLGTGT
GAIALALASERPDCKVTGVDLQPDAVALARHNAQKLSIGNAQFLQGSWFAPLAGETFALI
ASNPPYIDAADPHLAQGDVRFEPSSALVAPQQGLADLSAIVQQAPHHLQSQGWLLLEHGW
QQGESVRALLQAAGFISIDTRRDYGGNDRVTFGQWPQQSLKINNNEAHSD