Protein Info for IAI46_10270 in Serratia liquefaciens MT49

Annotation: lipoprotein localization protein LolB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00548: outer membrane lipoprotein LolB
  • amino acids 8 to 205 (198 residues), 246.2 bits, E=1.1e-77
• PF03550: LolB
  • amino acids 51 to 204 (154 residues), 156.5 bits, E=5.6e-50

Best Hits

Swiss-Prot: 97% identical to LOLB_SERP5: Outer-membrane lipoprotein LolB (lolB) from Serratia proteamaculans (strain 568)

KEGG orthology group: K02494, outer membrane lipoprotein LolB (inferred from 97% identity to spe:Spro_1988)

MetaCyc: 65% identical to outer membrane lipoprotein LolB (Escherichia coli K-12 substr. MG1655)
RXN-22553

Predicted SEED Role

"Outer membrane lipoprotein LolB precursor"

MetaCyc Pathways

• lipoprotein posttranslational modification (Gram-negative bacteria) (6/7 steps found)

Protein Sequence (207 amino acids)

>IAI46_10270 lipoprotein localization protein LolB (Serratia liquefaciens MT49)
MPIRKVSLLRLIPLASLVLAACTTTKPSGPATSPTSPQWRAHEQAVQQLEQYQTRGSFAY
LSDQKKVYARFFWQQYSSDRYRLLLTNPLGSTELDLNVQKNVVQLTDNQGKRYVSDNAEE
MIRKLTGMAIPLDNLRQWMLGLPGEANDFKLDDQYRLNSLTYQQGGQTWTVDYQDYNNSL
QPQLPSRLELKQGDQRIKLKMDNWTLK