Protein Info for IAI46_10210 in Serratia liquefaciens MT49

Annotation: NupC/NupG family nucleoside CNT transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 31 to 51 (21 residues), see Phobius details amino acids 66 to 83 (18 residues), see Phobius details amino acids 93 to 125 (33 residues), see Phobius details amino acids 130 to 152 (23 residues), see Phobius details amino acids 173 to 195 (23 residues), see Phobius details amino acids 201 to 220 (20 residues), see Phobius details amino acids 242 to 260 (19 residues), see Phobius details amino acids 266 to 288 (23 residues), see Phobius details amino acids 297 to 316 (20 residues), see Phobius details amino acids 354 to 380 (27 residues), see Phobius details amino acids 393 to 420 (28 residues), see Phobius details TIGR00804: nucleoside transporter, NupC family" amino acids 4 to 413 (410 residues), 493.2 bits, see alignment E=3.1e-152 PF01773: Nucleos_tra2_N" amino acids 9 to 81 (73 residues), 89.8 bits, see alignment E=1.9e-29 PF07670: Gate" amino acids 99 to 195 (97 residues), 52.9 bits, see alignment E=6.7e-18 PF07662: Nucleos_tra2_C" amino acids 201 to 411 (211 residues), 236.7 bits, see alignment E=3.4e-74

Best Hits

Swiss-Prot: 73% identical to PSUT_ECOLI: Putative pseudouridine transporter (psuT) from Escherichia coli (strain K12)

KEGG orthology group: K03317, concentrative nucleoside transporter, CNT family (inferred from 91% identity to srs:SerAS12_1927)

MetaCyc: 71% identical to putative nucleoside transporter (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Inner membrane transport protein YeiM, in cluster with pseudouridine metabolism operon"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (423 amino acids)

>IAI46_10210 NupC/NupG family nucleoside CNT transporter (Serratia liquefaciens MT49)
MDLLRSLSGICILLLIAFIFSNNRKRISLRTVFSALILQVLLGAIMLYVPAGKWGVNAIA
GGVNKVISYSDAGSSFIFGGLVGPKMNVLFDGAGFVFAFHVLPAIIFITALISILYYLGV
MGWVINLLGYVFQKMLSISKVEAFAAVTTIFLGQNELPAVLKPFINKMSRNELFTVICSG
MASIAGSMLVGYAGLGVPIEYLLAASLMAIPGGILFARMLSPATEASQVEFSQMAFSEKR
PASIIEAAASGAMLGLKIAVGVATVVMAFVALIALINGLIGGVGSLFGWQQLSLERLFGY
VFSPLAYIMGVSWDNAGVVGGLIGQKLAINEFVAYVNFSAYLKDSVAVLDPKTIAVISFA
LCGFANFGSIAVVVGAFSAVAPERASDIASLGLRALLAATLSNLMSATIAGLFIGLGALS
VAL