Protein Info for IAI46_10120 in Serratia liquefaciens MT49

Annotation: TRAP transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 652 transmembrane" amino acids 28 to 49 (22 residues), see Phobius details amino acids 56 to 76 (21 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 120 to 137 (18 residues), see Phobius details amino acids 143 to 166 (24 residues), see Phobius details amino acids 186 to 217 (32 residues), see Phobius details amino acids 237 to 259 (23 residues), see Phobius details amino acids 282 to 306 (25 residues), see Phobius details amino acids 312 to 333 (22 residues), see Phobius details amino acids 354 to 373 (20 residues), see Phobius details amino acids 379 to 397 (19 residues), see Phobius details amino acids 422 to 450 (29 residues), see Phobius details amino acids 457 to 475 (19 residues), see Phobius details amino acids 478 to 521 (44 residues), see Phobius details amino acids 541 to 562 (22 residues), see Phobius details amino acids 570 to 595 (26 residues), see Phobius details amino acids 606 to 638 (33 residues), see Phobius details TIGR02123: TRAP transporter, 4TM/12TM fusion protein" amino acids 31 to 642 (612 residues), 662.1 bits, see alignment E=4.7e-203 PF06808: DctM" amino acids 132 to 563 (432 residues), 306 bits, see alignment E=2e-95

Best Hits

KEGG orthology group: None (inferred from 86% identity to pmr:PMI1055)

Predicted SEED Role

"TRAP-type uncharacterized transport system, fused permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (652 amino acids)

>IAI46_10120 TRAP transporter permease (Serratia liquefaciens MT49)
MSTNNLSPQNAVDLDKEAGAGSRPLSGIYLQLATVLAIAISAYAIYANALSNTQEFYRNT
TFLSGILILGFILFPVSRRHSTSKFNRWDYLFIILTLVSYGYFYASYLDLHVVRKSIPNT
TDYVMAVIGIGVLFEAARRTTGYFIPGLATFAIVYALFGQYFMGIFGHGGFSFERLLYRL
FMTSEGIFGITLSTASTAIVVFILFGAFLSVSGATALFNDLALAMAGRRRGGPAQVAVIS
SALTGSLSGSAVANVATTGTFTIPLMKSIGLSSRFAGAVEATASTGGMIMPPIMGAAAFI
MAGFLGISYTTIVIAAIIPALLYYAALIIAIDLEAKKQGLKGISKENIPKVKAVLKARGL
LLLPLIIVIGTLLLGKTPIYAGFLGIISIIVASWITPDTTVRMTPKKIAEALNEAARGSI
QVTIACAAIGVIICVVTMTGIGSTLAFNIVAMTNNTLWMILLVVMLVCIVLSMGLPSTAL
YIVVAVTVSPILIKAGVMPLAAHFFVFWFGALSNITPPVALASYTAASIARADPMQTSWD
AVRLALPGFIIPFILVYNPMLLMQGDDLNALSVIHMVISALVGIYALSIASANFWMMKTH
WLERILFTFAAILLIKPGLLTDLGGAALIVTAASMHLLRFRRSHPQRAVNDQ