Protein Info for IAI46_10100 in Serratia liquefaciens MT49

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 transmembrane" amino acids 29 to 48 (20 residues), see Phobius details amino acids 60 to 82 (23 residues), see Phobius details amino acids 88 to 105 (18 residues), see Phobius details amino acids 122 to 145 (24 residues), see Phobius details amino acids 151 to 170 (20 residues), see Phobius details amino acids 186 to 207 (22 residues), see Phobius details amino acids 236 to 259 (24 residues), see Phobius details amino acids 272 to 305 (34 residues), see Phobius details amino acids 309 to 311 (3 residues), see Phobius details amino acids 317 to 335 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 61 to 331 (271 residues), 148 bits, see alignment E=1.5e-47

Best Hits

Swiss-Prot: 38% identical to MGLC_ECOLI: Galactoside transport system permease protein MglC (mglC) from Escherichia coli (strain K12)

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 99% identity to spe:Spro_1963)

MetaCyc: 38% identical to D-galactose/methyl-galactoside ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-18-RXN; TRANS-RXN0-541

Predicted SEED Role

"Inositol transport system permease protein" in subsystem Inositol catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (342 amino acids)

>IAI46_10100 ABC transporter permease (Serratia liquefaciens MT49)
MSNVKIEKPLAGKAPLFSGLSGKMPKDTGIFIVMIGIALVFEILGWYIRDQSFLMNPNRL
LLIVLQVAIIGIIAVGVTQVIITTGIDLSSGSLIALTAVVAASLAQTSDSISPMYPALLD
LPAAIPIGAGIGVGIVCGFINGFLITRTGIPPFIATLGMMVSARGLAQYYTQGNPVSFLS
DGFTSIGQGAMPVIIFLVIAVIFHIALKHTRYGKYIYAIGGNMTSARVSGINVNKYLVTV
YTIAGGLAGLAGVVLAARVSSGQSSMGMSYELDAIAAAVIGGSSLMGGVGRITGTLIGAV
ILGLIKSGFTFIGVDSYIQDIIKGVIIVAAVSIDMHRNRKKH