Protein Info for IAI46_10080 in Serratia liquefaciens MT49

Annotation: two-component system sensor histidine kinase DcuS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 533 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details PF17203: sCache_3_2" amino acids 42 to 172 (131 residues), 66.9 bits, see alignment E=5.2e-22 PF00989: PAS" amino acids 216 to 316 (101 residues), 30.1 bits, see alignment E=1.1e-10 PF14689: SPOB_a" amino acids 332 to 377 (46 residues), 33.9 bits, see alignment 4.6e-12 PF02518: HATPase_c" amino acids 428 to 530 (103 residues), 67.3 bits, see alignment E=4.1e-22 PF14501: HATPase_c_5" amino acids 428 to 520 (93 residues), 38.5 bits, see alignment E=2.3e-13

Best Hits

Swiss-Prot: 52% identical to DCUS_ECO57: Sensor histidine kinase DcuS (dcuS) from Escherichia coli O157:H7

KEGG orthology group: K07701, two-component system, CitB family, sensor histidine kinase DcuS [EC: 2.7.13.3] (inferred from 95% identity to spe:Spro_1959)

MetaCyc: 52% identical to sensor histidine kinase DcuS (Escherichia coli K-12 substr. MG1655)
Histidine kinase. [EC: 2.7.13.3]

Predicted SEED Role

"Fumarate respiration sensor kinase protein DcuS"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (533 amino acids)

>IAI46_10080 two-component system sensor histidine kinase DcuS (Serratia liquefaciens MT49)
MPKQRIPLKLSTTLTLMVSAIIASVLLVVYALFFVQMSHEGQDQQRQKAMAIAETVALSG
NVVDGLQREDHSGAIQRFAEQVRHQNELLFVTVVDMKGIRYSHPKPWLIGKHFIGDDLEP
ALHGKTNSAINRGALAPSLRVFAPVYDSERRQIGVVALGIALDTVHRVVAESRWIIYLTL
AFAALVGTLGIFFLVKALKRIMLGFEPYEISNLFEQRNAMLQSIKEGVIAVDNQSRITIV
NDEAKRLLRQSGPFENLLLESASKYWPAQLHLAEVLASGKPLRDQQISFNGSELLTNTVP
VIVKGQVIGAIATFRDKTEISQLVQRLSGMAHYADALRVQSHEFMNKLHVILGMLHMKAY
QQLENYIINTASNYQEEIGALLRKIQSPEVAGFFIGKISRAHEAGIELTIDETSLLPETD
DAETTHVLISVLGNLIENAIDAIDGVEGHEINLNFHHNENHLHCIISDDGPGIDPALGAR
IFEQGVSTKGPGRGIGLALIRSSLEKLGGSIDFESEPGVLTQFFVHIPYQAKG