Protein Info for IAI46_10010 in Serratia liquefaciens MT49

Annotation: copper homeostasis membrane protein CopD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 45 to 67 (23 residues), see Phobius details amino acids 94 to 112 (19 residues), see Phobius details amino acids 119 to 139 (21 residues), see Phobius details amino acids 156 to 177 (22 residues), see Phobius details amino acids 198 to 218 (21 residues), see Phobius details amino acids 230 to 247 (18 residues), see Phobius details amino acids 266 to 290 (25 residues), see Phobius details PF05425: CopD" amino acids 188 to 286 (99 residues), 74.3 bits, see alignment E=4.8e-25

Best Hits

KEGG orthology group: K07245, putative copper resistance protein D (inferred from 95% identity to spe:Spro_1944)

Predicted SEED Role

"Copper resistance protein D" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (293 amino acids)

>IAI46_10010 copper homeostasis membrane protein CopD (Serratia liquefaciens MT49)
MSLATLFVLCRFVHFAAVMLMFGSSLFTALLSPQRLSPYLTRDVRPLLVSCTWLAGLSAI
ALLAIQAGQMGDGWADTWRLDVWWAVLGTTFGEVWRWHLGISMLALLSLWLAEPRRTQLL
ALLSTLLLVSMAFIGHAAMHGGGLGALHRFNHALHLLAAGYWFGSLLPLLVSLRYLAQPQ
WRSDAVTTLIRFSRWGHLAVALVLLTGVINSLIILGSWPLDVDSPYQRLLLFKTALVALM
VMVALANRYAVVPAMSSMPRLAQRGLVLACWAELGLGAVVLLLVSLFATYAPV