Protein Info for IAI46_09985 in Serratia liquefaciens MT49

Annotation: RNA polymerase-binding protein DksA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 141 TIGR02420: RNA polymerase-binding protein DksA" amino acids 21 to 128 (108 residues), 116.4 bits, see alignment E=4.1e-38 PF21157: DksA_CC" amino acids 25 to 93 (69 residues), 48.1 bits, see alignment E=1.2e-16 PF01258: zf-dskA_traR" amino acids 97 to 131 (35 residues), 35.2 bits, see alignment E=1e-12

Best Hits

KEGG orthology group: K06204, DnaK suppressor protein (inferred from 94% identity to spe:Spro_1939)

Predicted SEED Role

"C4-type zinc finger protein, DksA/TraR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (141 amino acids)

>IAI46_09985 RNA polymerase-binding protein DksA (Serratia liquefaciens MT49)
MTVVSMLNQQQLLAMPESDYMNPAQRAFFRQRLLEEQQKLLQHIDALKRDIDSGEVSGDE
ADKAAREEDLRLLFRQLDRESRLLPKISAALTRLYNGDYGYCRESGEPIGLARLLLRPTA
ELSIEAKTAQEMREPHLRKRG