Protein Info for IAI46_09950 in Serratia liquefaciens MT49

Annotation: peptide MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 494 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 57 to 77 (21 residues), see Phobius details amino acids 87 to 107 (21 residues), see Phobius details amino acids 112 to 132 (21 residues), see Phobius details amino acids 148 to 169 (22 residues), see Phobius details amino acids 176 to 195 (20 residues), see Phobius details amino acids 216 to 236 (21 residues), see Phobius details amino acids 242 to 262 (21 residues), see Phobius details amino acids 274 to 293 (20 residues), see Phobius details amino acids 318 to 338 (21 residues), see Phobius details amino acids 355 to 375 (21 residues), see Phobius details amino acids 383 to 407 (25 residues), see Phobius details amino acids 419 to 440 (22 residues), see Phobius details amino acids 460 to 482 (23 residues), see Phobius details TIGR00924: amino acid/peptide transporter (Peptide:H+ symporter)" amino acids 20 to 486 (467 residues), 223.3 bits, see alignment E=3.4e-70 PF07690: MFS_1" amino acids 23 to 293 (271 residues), 57.5 bits, see alignment E=1.2e-19 amino acids 317 to 490 (174 residues), 34.5 bits, see alignment E=1.1e-12 PF00854: PTR2" amino acids 87 to 445 (359 residues), 114.9 bits, see alignment E=4.3e-37

Best Hits

KEGG orthology group: K03305, proton-dependent oligopeptide transporter, POT family (inferred from 97% identity to spe:Spro_1932)

Predicted SEED Role

"Di-/tripeptide transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (494 amino acids)

>IAI46_09950 peptide MFS transporter (Serratia liquefaciens MT49)
MTPSDSTTAAPQRHAIPPGAGALFFIQIFATLGFAVLYSTLVLYATKRLGFSEGSANAMM
GVFGAFNYGLHMFGGYLGGRFLSNRNLFVLGMVLQVIGCALIAVAGVWGLYWGLAMFLTG
SGLNVTCINMMLTQRFKPDDDRRESAFLWNYAGMNLGFFVGFTVAGYFQLTENYRALFLF
ATLGNAAAIIVAVSRWRILADLNTPLHDASRSQYRWRMLVGLAVLVALVPIIRVMLTHAE
FSGHFVIGLGVLIFLMLCVVTLRHHPRDERRRMTAYLILALGSLVFWALYQLAPMGLMLF
SEHNINLNVYGIQVAPQWIQNINTLVIVVGGPLMAWWFNRLRARGCNIDIPMQFSGSLFC
IGLGMLVLPLGISLAGGDGLVAFKWIAISYVLQSIGELMISPIGYAMIGKLAPPRYQGVM
MGCWMMVTGVASVLAGYVSGLMPENSGSTPLQTNPGYSEVFSVLGWGAAGVGVVMLILIP
LLRRLIRHDAPAAA