Protein Info for IAI46_09895 in Serratia liquefaciens MT49

Annotation: thiamine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 TIGR02721: thiamine kinase" amino acids 29 to 282 (254 residues), 300.6 bits, see alignment E=3.9e-94 PF01636: APH" amino acids 87 to 230 (144 residues), 54.6 bits, see alignment E=1.4e-18 PF01633: Choline_kinase" amino acids 171 to 217 (47 residues), 33.9 bits, see alignment 2.5e-12

Best Hits

KEGG orthology group: K07251, thiamine kinase [EC: 2.7.1.89] (inferred from 83% identity to spe:Spro_1923)

Predicted SEED Role

"Thiamine kinase (EC 2.7.1.89) @ Adenosylcobinamide kinase (EC 2.7.1.156)" (EC 2.7.1.156, EC 2.7.1.89)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.156 or 2.7.1.89

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (291 amino acids)

>IAI46_09895 thiamine kinase (Serratia liquefaciens MT49)
MAPSNTEATLLALIENELPAVKTAGCRFSPVQGLTGESWRIEGEGVHLLARQQSPEKSAL
GVSRRREARMLHRRGKDIGPQVLVQNNQWIILQWLDGDVVTDADFSRLNEQGDLAALLAG
LHRQPPSGYPLNLPRQFARYWQQLDGRRLTPAWLRLHQHFQHRRTPTPLKLAPLHMDVHP
GNLIVQGENLRLIDWEYAADGDIALDIAALFCSNAWSPARRQQFLQHYARIGYLDLPLLR
RQVQRWLPWVDYLMLLWFEVRWQQTGDPEFLRWGAVLHRRFCLTSHVLYLK