Protein Info for IAI46_09845 in Serratia liquefaciens MT49

Annotation: Nramp family divalent metal transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 transmembrane" amino acids 29 to 47 (19 residues), see Phobius details amino acids 66 to 85 (20 residues), see Phobius details amino acids 103 to 122 (20 residues), see Phobius details amino acids 128 to 128 (1 residues), see Phobius details amino acids 130 to 157 (28 residues), see Phobius details amino acids 169 to 189 (21 residues), see Phobius details amino acids 209 to 230 (22 residues), see Phobius details amino acids 255 to 279 (25 residues), see Phobius details amino acids 299 to 322 (24 residues), see Phobius details amino acids 342 to 360 (19 residues), see Phobius details amino acids 366 to 387 (22 residues), see Phobius details amino acids 406 to 430 (25 residues), see Phobius details TIGR01197: metal ion transporter, metal ion (Mn2+/Fe2+) transporter (Nramp) family" amino acids 34 to 394 (361 residues), 327.3 bits, see alignment E=8.3e-102 PF01566: Nramp" amino acids 52 to 401 (350 residues), 421.9 bits, see alignment E=1e-130

Best Hits

Swiss-Prot: 70% identical to MNTH_GRABC: Divalent metal cation transporter MntH (mntH) from Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)

KEGG orthology group: K03322, manganese transport protein (inferred from 98% identity to spe:Spro_1916)

MetaCyc: 49% identical to Mn2+/Fe2+: H+ symporter MntH (Escherichia coli K-12 substr. MG1655)
RXN0-2421; TRANS-RXN-241

Predicted SEED Role

"Manganese transport protein MntH" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (434 amino acids)

>IAI46_09845 Nramp family divalent metal transporter (Serratia liquefaciens MT49)
MRDAATTTSLTERTNTAIGNALAGRKRGAFTPLLFAGPAVIASIAYMDPGNFATNIQAGS
KYGYSLLWVVVMANLIAMLFQALSAKLGIVTQRNLAEMCRDQFSRPVVIGMWLLSEVAAM
ATDLAEFLGGAIALALLFHMPLLPGMGVTAVITYALLMVEKKGFRPVELMIGGLVAIIAL
CYLVEMFIVPVDWAAAGMGMVTPQLPDAQALTIAVGIIGATVMPHAIFLHSGLTQHRAPA
SDSGERRKLLRFSNIEVVIALSVAGLVNIAMVIMASSAFHAGNSDVAEIGTAYHTLTPLF
GAAAAGIFLMSLIASGISSSVVGTMAGQMIMQGFVGFRIPVWVRRMVTMVPAFIVVALGV
NATDALVYSQVVLSLALPAPMIALVMFTRRRDIMGEFVNSRLTSLVSIIGTVIIILLNMV
LLLQTFGVAIPGLG