Protein Info for IAI46_09765 in Serratia liquefaciens MT49

Annotation: 23S rRNA accumulation protein YceD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 PF02620: YceD" amino acids 62 to 171 (110 residues), 64.5 bits, see alignment E=4.9e-22

Best Hits

Swiss-Prot: 82% identical to YCED_SALTY: Large ribosomal RNA subunit accumulation protein YceD (yceD) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K07040, uncharacterized protein (inferred from 99% identity to spe:Spro_1901)

Predicted SEED Role

"COG1399 protein, clustered with ribosomal protein L32p"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (173 amino acids)

>IAI46_09765 23S rRNA accumulation protein YceD (Serratia liquefaciens MT49)
MQKVKLPLTIDAVRTAQKRLDYVGSYAPEQVTRVAASVVSVDSDVEVSLSFDIDNQRLAV
ITGHADVQVMLMCQRCGVPFEHHVHTTYCFSPVVNDEQAEALPGAYEPIEVDEFGEVDLL
AMIEDEIILSLPVVPVHESEHCEVSEADMVFGKLPPEAEKPNPFAVLASLKRK