Protein Info for IAI46_09700 in Serratia liquefaciens MT49

Annotation: AI-2E family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 transmembrane" amino acids 10 to 27 (18 residues), see Phobius details amino acids 33 to 51 (19 residues), see Phobius details amino acids 63 to 86 (24 residues), see Phobius details amino acids 144 to 165 (22 residues), see Phobius details amino acids 197 to 217 (21 residues), see Phobius details amino acids 223 to 246 (24 residues), see Phobius details amino acids 253 to 275 (23 residues), see Phobius details amino acids 288 to 313 (26 residues), see Phobius details PF01594: AI-2E_transport" amino acids 14 to 328 (315 residues), 249.5 bits, see alignment E=2.5e-78

Best Hits

Swiss-Prot: 59% identical to TQSA_ECOLI: AI-2 transport protein TqsA (tqsA) from Escherichia coli (strain K12)

KEGG orthology group: K11744, AI-2 transport protein TqsA (inferred from 93% identity to spe:Spro_1889)

MetaCyc: 59% identical to autoinducer 2 exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-453

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (350 amino acids)

>IAI46_09700 AI-2E family transporter (Serratia liquefaciens MT49)
MGRTLLTDRSLRLAILLAMLVIILAGVKAAADIVVPFLLAVFLAMVLNPLVTQLERWRIP
RVLGVTLLVVLVVVALMLFIGILGASLNEFARSLPQYRGMMMEKLSELQHYADRLNITIS
PEAMLQYVDPSSAMNLITRLLSRFSGAMTNIFLLLMTVVFMLFEVQLLPYKLQQALDKPS
EGIANIRRALDGVTRYLVIKTAISLATGVIVWGFLAAVDVRFAFIWGLLAFLLNYIPNIG
SVIAAVPPLIQALLFNGFGDALVVAAGFIAINLVIGNMLEPRVMGRGLGLSTLVVFLSLI
FWGWLMGPVGMLLSVPLTIITRIALETTEGGHKLAVILGDGQPGKPVTPE