Protein Info for IAI46_09695 in Serratia liquefaciens MT49

Annotation: cytochrome b

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 52 to 71 (20 residues), see Phobius details amino acids 90 to 111 (22 residues), see Phobius details amino acids 144 to 164 (21 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 10 to 180 (171 residues), 98.9 bits, see alignment E=1.6e-32

Best Hits

Swiss-Prot: 66% identical to C56I_ECOLI: Cytochrome b561 homolog 2 (yceJ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to spe:Spro_1888)

Predicted SEED Role

"Cytochrome B561"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (184 amino acids)

>IAI46_09695 cytochrome b (Serratia liquefaciens MT49)
MLWKNTANRFGHISVLIHWLVALTVYGMFALGLWMVTLGYYDVWYHQAPEIHKSIGTLLF
IVMVVRVIWRFVSPPPKPLASYGRFTRVSAILAHLALYVVLFSILISGYLISTADGQPIS
VFGWFDIPATATGMAEQADTAGTIHLYLAWAVVVLSVLHALAALKHHFVDRDVTLKRMLG
SSAD