Protein Info for IAI46_09675 in Serratia liquefaciens MT49

Annotation: LpxL/LpxP family Kdo(2)-lipid IV(A) lauroyl/palmitoleoyl acyltransferasee

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03279: Lip_A_acyltrans
  • amino acids 5 to 297 (293 residues), 353.2 bits, E=5.5e-110
• TIGR02207: lipid A biosynthesis lauroyl (or palmitoleoyl) acyltransferase
  • amino acids 5 to 306 (302 residues), 475.6 bits, E=3.4e-147

Best Hits

Swiss-Prot: 68% identical to LPXL_ECO57: Lipid A biosynthesis lauroyltransferase (lpxL) from Escherichia coli O157:H7

KEGG orthology group: K02517, lipid A biosynthesis lauroyl acyltransferase [EC: 2.3.1.-] (inferred from 99% identity to spe:Spro_1884)

MetaCyc: 68% identical to lauroyl acyltransferase (Escherichia coli K-12 substr. MG1655)
LAUROYLACYLTRAN-RXN [EC: 2.3.1.241]

Predicted SEED Role

"Lipid A biosynthesis lauroyl acyltransferase (EC 2.3.1.-)" in subsystem KDO2-Lipid A biosynthesis (EC 2.3.1.-)

MetaCyc Pathways

• superpathway of (Kdo)₂-lipid A biosynthesis (17/17 steps found)
• (Kdo)₂-lipid A biosynthesis (E. coli) (2/2 steps found)
• superpathway of Kdo₂-lipid A biosynthesis (18/25 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.241

Protein Sequence (306 amino acids)

>IAI46_09675 LpxL/LpxP family Kdo(2)-lipid IV(A) lauroyl/palmitoleoyl acyltransferasee (Serratia liquefaciens MT49)
MTQVPSFNRSLLHPRYWLTWFGIGLLYLLVLLPYPIIYRLGTWLGRFSMRFLKRRVAIAQ
RNLVLCFPDMPQAERDALVVQNFESVGMGLFETGMAWFWPNWRIERWFKVSGLEHIQKAR
DNHQGVLLIGLHFLTLELGARIFGIHNPGIGVYRPHDNKLMDWLQTWGRMRSNKSMLDRK
DVKGMIRALKQGDIIWYAPDHDYGPRSSVFAPLFAVEKAATTTGSYVLVRMGKPAIIPFT
PRRLPDAKGYELIMQPAVENFPLDNELEAAAFMNKVVEKEILMAPDQYMWLHRRFKTRPE
GEPSLY