Protein Info for IAI46_09660 in Serratia liquefaciens MT49

Annotation: peptide MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 517 transmembrane" amino acids 32 to 50 (19 residues), see Phobius details amino acids 62 to 82 (21 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 118 to 144 (27 residues), see Phobius details amino acids 156 to 177 (22 residues), see Phobius details amino acids 183 to 204 (22 residues), see Phobius details amino acids 234 to 256 (23 residues), see Phobius details amino acids 262 to 284 (23 residues), see Phobius details amino acids 293 to 311 (19 residues), see Phobius details amino acids 338 to 362 (25 residues), see Phobius details amino acids 375 to 393 (19 residues), see Phobius details amino acids 408 to 434 (27 residues), see Phobius details amino acids 445 to 464 (20 residues), see Phobius details amino acids 476 to 497 (22 residues), see Phobius details TIGR00924: amino acid/peptide transporter (Peptide:H+ symporter)" amino acids 11 to 502 (492 residues), 366 bits, see alignment E=1.7e-113 PF07690: MFS_1" amino acids 31 to 310 (280 residues), 70.3 bits, see alignment E=1.5e-23 PF00854: PTR2" amino acids 91 to 465 (375 residues), 228.8 bits, see alignment E=1.1e-71

Best Hits

KEGG orthology group: K03305, proton-dependent oligopeptide transporter, POT family (inferred from 98% identity to srs:SerAS12_1826)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (517 amino acids)

>IAI46_09660 peptide MFS transporter (Serratia liquefaciens MT49)
MQSSVNKQESRTFFGHPYPLGSLFFTEMWERFSFYGIRPLLILFMAATVYDGGMGLAREN
ASAIVGIFAGSMYLAALPGGWLADNWLGQQKAVWYGSILIALGHLSIALSALMGNNLFFI
GLMFIVLGSGLFKTCISVMVGTLYKKGDNRRDGGFSLFYMGINMGSFIAPLISGWLIRSH
GWHWGFGIGGIGMLVALVIFRVFAVPAMKRYDSEVGLDSTWNSPVAKKNGVGRWLLALAV
GVAVVITLIAQGIIVINPVAVASMLVYVIAASVTLYFIYLFVFAGLSRKERARLLVCFIL
LVSAAFFWSAFEQKPTSFNLFANDYTNRMIGDFEIPAVWFQSINALFIILLAPVFSWAWP
ALARNKVRLSSITKFVIGILFAAAGFGLMMLAAQNVLSNGGAGVSPMWLVGSILMLTLGE
LCLSPIGLATMTLLAPERMRGQMMGLWFCASALGNLAAGLIGGHVKADQLEMLPNLFARC
SIALLICAAVLTLLIVPIRRMMENTQGKSAQKPATNA