Protein Info for IAI46_09650 in Serratia liquefaciens MT49

Annotation: YeeE/YedE family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 139 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 41 to 61 (21 residues), see Phobius details amino acids 85 to 110 (26 residues), see Phobius details amino acids 116 to 137 (22 residues), see Phobius details PF20398: DUF6691" amino acids 5 to 134 (130 residues), 159.1 bits, see alignment E=4.3e-51

Best Hits

Swiss-Prot: 48% identical to Y1893_XYLFT: UPF0394 membrane protein PD_1893 (PD_1893) from Xylella fastidiosa (strain Temecula1 / ATCC 700964)

KEGG orthology group: K07112, (no description) (inferred from 86% identity to spe:Spro_1879)

Predicted SEED Role

"GENE II AND X PROTEINS"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (139 amino acids)

>IAI46_09650 YeeE/YedE family protein (Serratia liquefaciens MT49)
MYRSVFALLSGAIFGLGLIVAGMANPAKVLAFLDVTGHWDPSLALVMVGAIAVAAPAFFW
VRRRPRTLLGETVQLPSSRRIDRRLLAGSALFGIGWGMAGICPGPAWVLAGAGSSAGWQF
VAAMLAGMALYEVILLWRK