Protein Info for IAI46_09585 in Serratia liquefaciens MT49

Annotation: potassium/proton antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 573 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 30 to 47 (18 residues), see Phobius details amino acids 59 to 76 (18 residues), see Phobius details amino acids 88 to 114 (27 residues), see Phobius details amino acids 121 to 143 (23 residues), see Phobius details amino acids 164 to 186 (23 residues), see Phobius details amino acids 192 to 213 (22 residues), see Phobius details amino acids 221 to 238 (18 residues), see Phobius details amino acids 244 to 261 (18 residues), see Phobius details amino acids 273 to 290 (18 residues), see Phobius details amino acids 298 to 323 (26 residues), see Phobius details amino acids 335 to 356 (22 residues), see Phobius details amino acids 363 to 385 (23 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 15 to 388 (374 residues), 214.1 bits, see alignment E=4.4e-67 PF02080: TrkA_C" amino acids 421 to 483 (63 residues), 47.8 bits, see alignment E=1.6e-16 PF03471: CorC_HlyC" amino acids 494 to 570 (77 residues), 57.7 bits, see alignment E=1.4e-19

Best Hits

Swiss-Prot: 84% identical to NHAP2_YERPS: K(+)/H(+) antiporter NhaP2 (nhaP2) from Yersinia pseudotuberculosis serotype I (strain IP32953)

KEGG orthology group: K11105, cell volume regulation protein A (inferred from 98% identity to srs:SerAS12_1811)

Predicted SEED Role

"Cell volume regulation protein A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (573 amino acids)

>IAI46_09585 potassium/proton antiporter (Serratia liquefaciens MT49)
MDASTINSLFIIGAVLVGASILLSSFSSRLGIPILVIFLAIGMLAGVDGPGGIVFSNYPV
AYLVSNLALAVILLDGGMRTRVSSFRVALWPALSLATIGVVITAGLTGLAAAWLFNLDLL
QGMLIGAIIGSTDAAAVFSLLGGKGLNERVSATLEIESGSNDPMAVFLTITLIAMIAAGE
TTLSWMFPLHLLQQFGMGIIFGLGGGWLLLTLINHIKLAEGLYPLLAVSGGILIFALTTA
LDGSGILAVYLCGLMLGNRPIRNRHGIVQTFDGLAWLSQIGMFLVLGLLLNPHELLPIAI
PALLLSLWMILFARPLSVFIGLLPFRSFTLRERSFISWVGLRGAVPVILAVFPMMAGLPN
AQLFFNVAFFVVLVSLLLQGTTLSFAAKKAKVIVPPALAPISRVGLDVHPENQWEQFVYQ
LSSENWCVGAALRELKMPPGTRIAALFRGKELLHPSGSTRLREDDILCVIGHEHDLPVLG
KLFSQAPVVTLDERFFGDFILQSDARLSDISQVYGLNLHEGVDEQQTLGQFVIQLIGGEP
VVGDQIEWDGLTWTIAEMDGNAISKVGVRIVTD