Protein Info for IAI46_09280 in Serratia liquefaciens MT49

Annotation: MacB family efflux pump subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 646 transmembrane" amino acids 272 to 293 (22 residues), see Phobius details amino acids 518 to 543 (26 residues), see Phobius details amino acids 570 to 597 (28 residues), see Phobius details amino acids 607 to 629 (23 residues), see Phobius details PF00005: ABC_tran" amino acids 24 to 172 (149 residues), 109.8 bits, see alignment E=2.6e-35 PF12704: MacB_PCD" amino acids 272 to 489 (218 residues), 140.3 bits, see alignment E=1.6e-44 PF02687: FtsX" amino acids 524 to 639 (116 residues), 67.6 bits, see alignment E=1.5e-22

Best Hits

Swiss-Prot: 76% identical to MACB2_ECOK1: Macrolide export ATP-binding/permease protein MacB 2 (macB2) from Escherichia coli O1:K1 / APEC

KEGG orthology group: K05685, macrolide transport system ATP-binding/permease protein [EC: 3.6.3.-] (inferred from 92% identity to spe:Spro_1862)

Predicted SEED Role

"Macrolide export ATP-binding/permease protein MacB (EC 3.6.3.-)" in subsystem Multidrug Resistance Efflux Pumps (EC 3.6.3.-)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (646 amino acids)

>IAI46_09280 MacB family efflux pump subunit (Serratia liquefaciens MT49)
MNTIIELKGIGRTYTNSSEPLTVLKNINLKIAAGELVAIIGASGSGKSTLMNIIGCLDVP
DQGDYFISGHNAAHLSPDELARLRREHIGFIFQRYHLMPDISALGNVEIPAIYANSKRDQ
RRLRAAQLLARLGLEGREHHKPGQLSGGQQQRVSIARSLINGGEIILADEPTGALDSKSG
QEVLAILSELNQRGHTVVIVTHDMKVAQHAQRIIELQDGEIVADSGCQSPVPPPVMKKSP
PVAQGYWQSLLDRTRESLQMALKAMNAHRLRTALTMTGIIFGIAAVVTVVALGEGAKQRT
LESIKDLGTNVVSIYPGRDFFDDSIDSIRTLVPADADALASQSFVDSVSPEVSASENIRF
RSKSANASISGVGRDNLRVSGLKLIQGRNFLDDRNALQEVIIDENARQALFGDFGVEPLG
QIVFLGAVPARVVGVVQSNQDSAPNRIRVWMPYSTVMYRMVGKSTLSSINVRLKEDVSNE
AAVAAIKQLLTQRHGVKDFMLFNLDKYRKSIEHTSMTLTLLILMVASISLIIGSLGVMNI
MLVSVTERTHEIGVRMAVGARRSDIMQQFMIEAVLVCLIGGALGILLSFAAGSLFTLLAG
GMLTAIYSWQAAAVAFCCSTLIGMIFGYLPARKAARMDPVISLASE