Protein Info for IAI46_09135 in Serratia liquefaciens MT49

Annotation: Ldh family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 PF02615: Ldh_2" amino acids 9 to 332 (324 residues), 336 bits, see alignment E=1.2e-104

Best Hits

Swiss-Prot: 66% identical to PY2CR_PSEAE: Delta(1)-pyrroline-2-carboxylate/Delta(1)-piperideine-2-carboxylate reductase (lhpD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 92% identity to spe:Spro_1835)

MetaCyc: 36% identical to R-sulfolactate oxidoreductase (Chromohalobacter salexigens DSM 3043)
RXN-11690 [EC: 1.1.1.338]

Predicted SEED Role

"Ureidoglycolate/malate/sulfolactate dehydrogenase family (EC 1.1.1.-)" in subsystem Proline, 4-hydroxyproline uptake and utilization (EC 1.1.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.- or 1.1.1.338

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (337 amino acids)

>IAI46_09135 Ldh family oxidoreductase (Serratia liquefaciens MT49)
MTQTQRLTLEQAYELALKALRSNGFSAEHADAVAQNVTAGERDGCASHGLYRVLGCVRSL
LAGKVSADARPTLIDQAPAILRVDAHDAFSLLAYRTALPVFVEKVRTNGIAALAINHCVH
YSALWADIEPLTDQGLVALACTPSHAWVTPAGGSRPLFGTNPIAFGWPRPQRPPFIFDMA
TSAAARGEIELHRRAGTPLPPGWGIDQQGKPSTDAQSVLQGAMLTFGGHKGSALAAMVEL
LAGPLIGDMTSKESLAYDRQTGSSPYGGELIIAMDPDRFLGPDKVAHLARAEALFADMSE
QGARIPGERRFQQRQYSEQHGVTIPQALYEEIAALCR