Protein Info for IAI46_09110 in Serratia liquefaciens MT49

Annotation: 5-aminolevulinate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 TIGR01821: 5-aminolevulinic acid synthase" amino acids 5 to 400 (396 residues), 508.9 bits, see alignment E=4.6e-157 PF00155: Aminotran_1_2" amino acids 50 to 390 (341 residues), 233 bits, see alignment E=3.3e-73

Best Hits

Swiss-Prot: 47% identical to HEM0_RHOS4: 5-aminolevulinate synthase 2 (hemT) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

KEGG orthology group: K00643, 5-aminolevulinate synthase [EC: 2.3.1.37] (inferred from 96% identity to spe:Spro_1830)

MetaCyc: 47% identical to 5-aminolevulinate synthase 2 (Cereibacter sphaeroides)
5-aminolevulinate synthase. [EC: 2.3.1.37]

Predicted SEED Role

"5-aminolevulinate synthase (EC 2.3.1.37)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 2.3.1.37)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.37

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (403 amino acids)

>IAI46_09110 5-aminolevulinate synthase (Serratia liquefaciens MT49)
MSVLNILEEKLAETKKQGRFREFLNLERSVLDKPWATSHGQQGERRLNVWCSNDYLAMSH
HPKVILATTEAVNSVGLGTCGARSISGTSIYHSELESLLAKAYGKESALLFTTGFGANDA
TLSTLCDAIPNLIVFSDELNHASMIYGIRYSKAEKKIFRHNDVAHLAELLQEADPQRPKL
IAFESLYSMDGDFAPLAQIVALAEKHQALTYLDEIHSAGVYGQRGLGYAEQLGLLDKITI
IQGGFGKSYGAAGGYIAAPRAVVEAVRSWAPAFVFSTSSPAPVVAAALASFKYNLEHDNQ
RKHLLAIIDHLKSGLRAAGIPLVSEDSHILPVLVGDPHRNKHISKQLLDEYDIYVQPVNA
PTVPAGSERLRVTPTSAHTHEDVEYFLAALSKIWAANALRRAG