Protein Info for IAI46_09105 in Serratia liquefaciens MT49

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 50 to 71 (22 residues), see Phobius details amino acids 78 to 101 (24 residues), see Phobius details amino acids 107 to 128 (22 residues), see Phobius details amino acids 136 to 159 (24 residues), see Phobius details amino acids 167 to 189 (23 residues), see Phobius details amino acids 209 to 231 (23 residues), see Phobius details amino acids 243 to 263 (21 residues), see Phobius details amino acids 274 to 293 (20 residues), see Phobius details amino acids 299 to 317 (19 residues), see Phobius details amino acids 329 to 356 (28 residues), see Phobius details amino acids 362 to 383 (22 residues), see Phobius details PF07690: MFS_1" amino acids 17 to 322 (306 residues), 142.4 bits, see alignment E=1.7e-45 amino acids 213 to 386 (174 residues), 35.6 bits, see alignment E=5.4e-13 PF12832: MFS_1_like" amino acids 43 to 355 (313 residues), 35.8 bits, see alignment E=5.2e-13

Best Hits

KEGG orthology group: None (inferred from 95% identity to spe:Spro_1829)

Predicted SEED Role

"FIG01055695: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (390 amino acids)

>IAI46_09105 MFS transporter (Serratia liquefaciens MT49)
MKLTDYNGHFLTLCLMATGTFAIGTDAFIVAGILDEISGTFAVSPAQAGQLISVFALAYM
VFAPLTAWLLGNLNRKHILQLALVLFIAGNLVCAYADSFLQISAGRVLAALGAACYTPQA
AAAAVGLVAEKRRGLAISIVYGGMTLAIALGIPFGTFLAKLIGWREIFLLIALLGAVALL
GLSLALNAIAAPGKHSLKERLAPLRQKAVLTTLLITFFAVCSEHIVYSYVSVLLKNTQLG
PEAILPLALLVFGIGAVIGNFVSGLLTDTFGSKFVLLFSVSIQTLSLFLLAFYVTSPWWV
LAIFLVWGITGWMYLVPIQHHLLSLSKRFGALTVSLNSSVLYAGIAAGGMLGGLTLYTLP
AYYLPLFSLPLGAIALLLTLVFFQGEKSHD