Protein Info for IAI46_09090 in Serratia liquefaciens MT49

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 28 to 51 (24 residues), see Phobius details amino acids 62 to 82 (21 residues), see Phobius details amino acids 88 to 112 (25 residues), see Phobius details amino acids 121 to 143 (23 residues), see Phobius details amino acids 155 to 177 (23 residues), see Phobius details amino acids 220 to 241 (22 residues), see Phobius details amino acids 253 to 275 (23 residues), see Phobius details amino acids 287 to 306 (20 residues), see Phobius details amino acids 312 to 331 (20 residues), see Phobius details amino acids 342 to 364 (23 residues), see Phobius details amino acids 376 to 396 (21 residues), see Phobius details PF07690: MFS_1" amino acids 1 to 362 (362 residues), 148.6 bits, see alignment E=1.2e-47

Best Hits

Swiss-Prot: 54% identical to RHMT_ECOLI: Inner membrane transport protein RhmT (rhmT) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 79% identity to ypy:YPK_2512)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (412 amino acids)

>IAI46_09090 MFS transporter (Serratia liquefaciens MT49)
MFSLYFVAFIDRVNVGFAKEAMSVDIGLSQSAFALGAGIFFAAYAIFGIPANLMMNKLGA
KVWLSATTAVWGALSACTGFVSNEYQFIALRFLLGLAEAGFYPGILLLASLYFPNKVRAS
VIGIFVLGVPAALTLGSPISGALLEMHGVLGQPGWFWMFVLEGLPAVVLGIFAYFYLDDS
PAKARFLNPEEKQALVAQLALEQTNTEASSVKEALKNSKVWHLAFIYGTIQVGVYGLLFF
LPSQVASLMGTNIGFKASLVAAIPWAVSAFGVYYIPRYADRKTSRRLPIAIGCMVIAALG
LVVSSYAGPTVAIIALCFCAVSFLAVQPIFWTLPAQILSGPALAAGIGFCTTLGALFSFL
APLIRTEAELRFDSPHAGLIVLAIFSLLCAALIFALKGWATQSAERQAQVSG