Protein Info for IAI46_09065 in Serratia liquefaciens MT49

Annotation: CDP-glycerol glycerophosphotransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 511 PF04464: Glyphos_transf" amino acids 299 to 438 (140 residues), 23.6 bits, see alignment E=1.2e-09

Best Hits

KEGG orthology group: None (inferred from 59% identity to rah:Rahaq_4501)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (511 amino acids)

>IAI46_09065 CDP-glycerol glycerophosphotransferase family protein (Serratia liquefaciens MT49)
MNKIATYLLAPFFKRFDAALHHSNDMIVDLDEKIHTLKNDILSENKKNRELLSQLLDEAK
NSSNESKNTADNLNKTNELLIGLSEKLESAIPENNHSLLEMKDNINKKILHINKTLNIIS
KKQNHRNKTPTVLFLIHNMNTWYSVANIYYALSADPDLNVIIASIPRSFPGVDGYTGETE
TSNSLAKIGVNHMRVSTSNDKDIATILTTLAPDVIFRQSPWDNDIPDGFSAEKINFAKIC
YIPYYAINIVKNMSSGTDFDFQSNQALHNNSWRIYCDTEYAYQELCRNSLLKGINARYFG
HPKLDFIHTQMIEYSKEKTNHKEVNILWAPHHSIDDGWLSFGTFDVNYFDFLTFAEENPK
INIMLRPHPALFDYMKAKSEETKNKVEEFIARWNSLDNTSIDYNHDYIDSFKWSDIMVTD
GISFLVEYPLFHKPIIFLENKNHAEFNEIGIIAVNCSHIAKDFIDVKNIVNKFENGTLEK
KQTAIDSLEEITLPNKGNVHNLIATDIKTNL