Protein Info for IAI46_09035 in Serratia liquefaciens MT49

Annotation: pyrimidine utilization protein D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 TIGR03611: pyrimidine utilization protein D" amino acids 1 to 255 (255 residues), 353.8 bits, see alignment E=2.6e-110 PF00561: Abhydrolase_1" amino acids 14 to 116 (103 residues), 72.8 bits, see alignment E=5.3e-24 PF12146: Hydrolase_4" amino acids 15 to 228 (214 residues), 58.5 bits, see alignment E=9.7e-20 PF12697: Abhydrolase_6" amino acids 16 to 245 (230 residues), 61.5 bits, see alignment E=2.9e-20

Best Hits

Swiss-Prot: 87% identical to RUTD_SERP5: Putative aminoacrylate hydrolase RutD (rutD) from Serratia proteamaculans (strain 568)

KEGG orthology group: K09023, protein RutD (inferred from 87% identity to spe:Spro_1820)

Predicted SEED Role

"Possible hydrolase or acyltransferase RutD in novel pyrimidine catabolism pathway" in subsystem Pyrimidine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (267 amino acids)

>IAI46_09035 pyrimidine utilization protein D (Serratia liquefaciens MT49)
MYFEILGKDTPLAPTLVLSAGLGGSGSFWQPQIDALTRHFRVVIYDHYGTGRSKGVVPDG
YSMADMADEVAQLLRSFSIERCYFVGHALGGMIGLQLALTQPQLLEKLVVVNGWPALDSQ
TRRCFHVRQDLLLNSGVEAYVRAQPLFLFPADWLSQHEALLGEELQHQTAHFQGTENLLR
RLNALINTDFRPHLADITTPTLALCARDDLLVPYLCSHQLAESLPNGELAQMTYGGHAMS
VTDSETFNRTLLDWLLKTPNASSSLAL