Protein Info for IAI46_09030 in Serratia liquefaciens MT49

Annotation: pyrimidine utilization flavin reductase protein F

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03615: pyrimidine utilization flavin reductase protein F
  • amino acids 17 to 172 (156 residues), 272.8 bits, E=4.3e-86
• PF01613: Flavin_Reduct
  • amino acids 26 to 172 (147 residues), 132.1 bits, E=9.1e-43

Best Hits

Swiss-Prot: 90% identical to RUTF_SERP5: FMN reductase (NADH) RutF (rutF) from Serratia proteamaculans (strain 568)

KEGG orthology group: K09024, putative flavin reductase RutF [EC: 1.5.1.-] (inferred from 91% identity to srs:SerAS12_1764)

MetaCyc: 71% identical to FMN reductase RutF (Escherichia coli K-12 substr. MG1655)
RXN-9510 [EC: 1.5.1.42]

Predicted SEED Role

"Predicted flavin reductase RutF in novel pyrimidine catabolism pathway" in subsystem Pyrimidine utilization

MetaCyc Pathways

• bacterial bioluminescence (4/8 steps found)
• dibenzothiophene desulfurization (1/5 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Methane metabolism
• Tryptophan metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.5.1.-

Use Curated BLAST to search for 1.5.1.- or 1.5.1.42

Protein Sequence (175 amino acids)

>IAI46_09030 pyrimidine utilization flavin reductase protein F (Serratia liquefaciens MT49)
MQSQTGFADAPLQPAHVEKQDFRDAMARLGSAVNIITTDGPAGRAGFTASAVCSVTDTPP
TLLVCLNRSASVYAVFKQNQTLCVNTLAAEHESLSNLFGGKTPMDMRFSAARWSTLVTGA
PILHGALASFDCQISQIVSVGTHDILFCQAVALARNDHSHGLAYFDRRYHSLLKQ