Protein Info for IAI46_09025 in Serratia liquefaciens MT49

Annotation: pyrimidine utilization transport protein G

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 transmembrane" amino acids 33 to 54 (22 residues), see Phobius details amino acids 59 to 76 (18 residues), see Phobius details amino acids 83 to 103 (21 residues), see Phobius details amino acids 109 to 133 (25 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 173 to 190 (18 residues), see Phobius details amino acids 197 to 219 (23 residues), see Phobius details amino acids 239 to 261 (23 residues), see Phobius details amino acids 319 to 338 (20 residues), see Phobius details amino acids 351 to 373 (23 residues), see Phobius details amino acids 385 to 401 (17 residues), see Phobius details amino acids 407 to 425 (19 residues), see Phobius details TIGR03616: pyrimidine utilization transport protein G" amino acids 1 to 428 (428 residues), 836.5 bits, see alignment E=3.7e-256 TIGR00801: uracil-xanthine permease" amino acids 26 to 424 (399 residues), 377.4 bits, see alignment E=9e-117 PF00860: Xan_ur_permease" amino acids 31 to 401 (371 residues), 337.2 bits, see alignment E=5.5e-105

Best Hits

Swiss-Prot: 79% identical to RUTG_ECOLI: Putative pyrimidine permease RutG (rutG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 96% identity to srr:SerAS9_1763)

MetaCyc: 79% identical to pyrimidine:H+ symporter (Escherichia coli K-12 substr. MG1655)
RXN-5076; TRANS-RXN-132; TRANS-RXN-362

Predicted SEED Role

"Uracil permease" in subsystem De Novo Pyrimidine Synthesis or Pyrimidine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (439 amino acids)

>IAI46_09025 pyrimidine utilization transport protein G (Serratia liquefaciens MT49)
MANTWFPQWRLKQGNLDGAVVAPDERLPVTQTLVMGLQHAVAMFGATVLMPLLMGFDANL
AILMSGIGTLLFFLVVGGRVPSYLGSSAAFVGLVITLTGYSGQGANPNIALALGGIIACG
LVYLLIGFVVMSVGTRWIERLMPPVVTGAVVMAIGLNLAPIAVRSVSASHFDSWMAVVTI
LCIGSVAVFTRGLMQRLLILVGLIAAYLIYVVATNGFGLGKPVDYSALSQAPWFGLPQFT
APVFNLHAMLLIAPVAIILVAENLGHVKAVAGMTGRDLDPYIGRAFVGDGLATMLSGSVG
GTGVTTYAENIGVMAVTKIYSTLVFVAAAAVAIVLGFSPKFGALIHTIPGPVLGGASIVV
FGLIAVAGARIWVQNKVDLGDNGNLIMVAVTLVLGAGDFALTLGNFTMGGIGTATFGAII
LNALLRNRKILPLADSATR