Protein Info for IAI46_08985 in Serratia liquefaciens MT49

Annotation: potassium transporter TrkG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 486 transmembrane" amino acids 7 to 33 (27 residues), see Phobius details amino acids 41 to 61 (21 residues), see Phobius details amino acids 73 to 94 (22 residues), see Phobius details amino acids 139 to 160 (22 residues), see Phobius details amino acids 189 to 208 (20 residues), see Phobius details amino acids 244 to 265 (22 residues), see Phobius details amino acids 278 to 297 (20 residues), see Phobius details amino acids 337 to 360 (24 residues), see Phobius details amino acids 400 to 419 (20 residues), see Phobius details amino acids 457 to 483 (27 residues), see Phobius details PF02386: TrkH" amino acids 42 to 480 (439 residues), 358.5 bits, see alignment E=2.6e-111 TIGR00933: potassium uptake protein, TrkH family" amino acids 87 to 469 (383 residues), 361 bits, see alignment E=4.3e-112

Best Hits

Swiss-Prot: 65% identical to TRKG_ECOLI: Trk system potassium uptake protein TrkG (trkG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 96% identity to spe:Spro_1811)

MetaCyc: 65% identical to Rac prophage; Na+-dependent K+ transporter TrkG (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-188

Predicted SEED Role

"Trk system potassium uptake protein TrkG" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (486 amino acids)

>IAI46_08985 potassium transporter TrkG (Serratia liquefaciens MT49)
MVKNKQILVVIHLCSFLVFLYSLSMIPPLLVALLYKEKSVFSFFYTLVIAGSLGGLGWFS
TRQAKVQLRTQDGFLIIVMFWLLFSMISALPLWLDDTLNVSLTDAMFEGVSGITTTGASV
LNDVSGIPKSFLYYRSQLNFIGGLGVIVLAVAVLPLLGIGGAKLYQSEMPGPFKEERLTP
RLADTSKNLWLIYLGLGLACTVAFRIAGMPWFDALCHGISTVSLGGFSTRNESLGYYDSS
AVEMVGGIFSILAAVNFTLYFVAVGRRSLKPLYKNPELRFFLLVLSIIVAIVCLELYRSG
MYGAKDSFVHGFFLTSSMMTDNGLATADYAKMPSHTIMLLLAASFFGGCVGSTCGGIKAL
RFLIMYKQSRHEINQLVHPNAVYTIKVGNAPIHDRVLRSVWSFFFLYVFFSCFFIWLLNL
MGYDLVTSFATVAACINNMGLGFGETAAGFGTLSDAAKWLMCAAMLLGRLEIYPMLILCS
RAFWRF