Protein Info for IAI46_08930 in Serratia liquefaciens MT49

Annotation: acyltransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 36 to 54 (19 residues), see Phobius details amino acids 75 to 93 (19 residues), see Phobius details amino acids 113 to 131 (19 residues), see Phobius details amino acids 137 to 155 (19 residues), see Phobius details amino acids 175 to 191 (17 residues), see Phobius details amino acids 197 to 215 (19 residues), see Phobius details amino acids 221 to 239 (19 residues), see Phobius details amino acids 258 to 275 (18 residues), see Phobius details amino acids 282 to 300 (19 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 7 to 299 (293 residues), 91.1 bits, see alignment E=3.7e-30

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (322 amino acids)

>IAI46_08930 acyltransferase family protein (Serratia liquefaciens MT49)
MLKKRDLSFDLLKGTLILLVIIGHVLPGSADSGLRGAIYFFHMPLFLGVTGYFIRRYFLD
AGVVSILNKYKWRMIIPYLLAFVIYSVYALYVTGKGDGINFKEIIGLGLYPYYHLWYIPA
VIIFVFYTLIIYKNKFSLGLFMFLSIVISIFWYCYADVMEDKYAVLKFIGDKRFYYYYSF
FLLGFCISDWKLRFKPMLFLPVTLASGVLSYYVANETLIDAGLWFVFNGSLIFMLIGLCK
DFDLKKENVLVKMGQVSLPIYLWHVIPIIVFGMLLDTNSIEFYVFIVISISIMILGFIAL
RGKTRFLDYYFYGERDKWQSEK