Protein Info for IAI46_08910 in Serratia liquefaciens MT49

Annotation: DUF2057 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF09829: DUF2057" amino acids 23 to 216 (194 residues), 174.7 bits, see alignment E=1.2e-55

Best Hits

Swiss-Prot: 36% identical to Y844_MANSM: UPF0319 protein MS0844 (MS0844) from Mannheimia succiniciproducens (strain MBEL55E)

KEGG orthology group: K09909, hypothetical protein (inferred from 90% identity to spe:Spro_1761)

Predicted SEED Role

"UPF0319 protein YccT precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (223 amino acids)

>IAI46_08910 DUF2057 family protein (Serratia liquefaciens MT49)
MKFGLMVAGLLSISISMPAVATTLKLSPDIDLLVVDGKKMTGALLKGADSLELDGGQHQL
LFKVAKSVRSGQHEQTAYTSPPLIATFSTQNVSSVAIELPRIENVRDGQRFDKTLNYQVI
DKNGNALAMKHDVLHADGATLSVDLEKVMADYNSQNRPASVPAFTQVRATTPSSPLASAA
LNSPTVTLKGENVSEQMLQYWFQQADKETQKRFLHWANKQPVR