Protein Info for IAI46_08905 in Serratia liquefaciens MT49

Annotation: methylglyoxal synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00160: methylglyoxal synthase
  • amino acids 11 to 151 (141 residues), 228.1 bits, E=1.8e-72
• PF02142: MGS
  • amino acids 26 to 118 (93 residues), 72.1 bits, E=1.7e-24

Best Hits

Swiss-Prot: 97% identical to MGSA_SERP5: Methylglyoxal synthase (mgsA) from Serratia proteamaculans (strain 568)

KEGG orthology group: K01734, methylglyoxal synthase [EC: 4.2.3.3] (inferred from 97% identity to spe:Spro_1760)

MetaCyc: 78% identical to methylglyoxal synthase (Escherichia coli K-12 substr. MG1655)
Methylglyoxal synthase. [EC: 4.2.3.3]

Predicted SEED Role

"Methylglyoxal synthase (EC 4.2.3.3)" in subsystem Methylglyoxal Metabolism (EC 4.2.3.3)

KEGG Metabolic Maps

• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.3.3

Protein Sequence (152 amino acids)

>IAI46_08905 methylglyoxal synthase (Serratia liquefaciens MT49)
MEFTTRTIAARKHIALVAHDHRKQALLAWVEENKSVLEHHQLYATGTTGNLIQRASGIPV
QSMLSGPMGGDQQVGALIAEGKIDMLIFFWDPLNAVPHDPDVKALLRLATVWNIPVATNR
STADFLIDSSLFKREVEIAIPDYQRYLQDRLK