Protein Info for IAI46_08860 in Serratia liquefaciens MT49

Annotation: bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01749: beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabA
  • amino acids 4 to 171 (168 residues), 306.4 bits, E=2.6e-96
• PF07977: FabA
  • amino acids 29 to 158 (130 residues), 178.3 bits, E=3e-57

Best Hits

Swiss-Prot: 100% identical to FABA_SERP5: 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase (fabA) from Serratia proteamaculans (strain 568)

KEGG orthology group: K01716, 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase [EC: 4.2.1.60] (inferred from 99% identity to srs:SerAS12_1723)

MetaCyc: 88% identical to beta-hydroxyacyl-acyl carrier protein dehydratase/isomerase (Escherichia coli K-12 substr. MG1655)
Trans-2-decenoyl-[acyl-carrier-protein] isomerase. [EC: 5.3.3.14]; 3-hydroxyoctanoyl-[acyl-carrier-protein] dehydratase. [EC: 5.3.3.14, 4.2.1.59]; 4.2.1.59 [EC: 5.3.3.14, 4.2.1.59]

Predicted SEED Role

"3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabA form (EC 4.2.1.59)" (EC 4.2.1.59)

MetaCyc Pathways

• biotin biosynthesis I (13/15 steps found)
• superpathway of fatty acids biosynthesis (E. coli) (40/53 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (16/20 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (13/16 steps found)
• 8-amino-7-oxononanoate biosynthesis I (9/11 steps found)
• (5Z)-dodecenoate biosynthesis I (5/6 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (7/9 steps found)
• cis-vaccenate biosynthesis (4/5 steps found)
• octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (9/12 steps found)
• palmitate biosynthesis III (21/29 steps found)
• gondoate biosynthesis (anaerobic) (3/4 steps found)
• oleate biosynthesis IV (anaerobic) (10/14 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (22/31 steps found)
• (5Z)-dodecenoate biosynthesis II (4/6 steps found)
• stearate biosynthesis II (bacteria and plants) (4/6 steps found)
• stearate biosynthesis IV (4/6 steps found)
• 8-amino-7-oxononanoate biosynthesis IV (3/5 steps found)
• fatty acid elongation -- saturated (3/5 steps found)
• superpathway of fatty acid biosynthesis II (plant) (30/43 steps found)
• tetradecanoate biosynthesis (mitochondria) (17/25 steps found)
• 2-allylmalonyl-CoA biosynthesis (2/8 steps found)
• anteiso-branched-chain fatty acid biosynthesis (18/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (18/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (18/34 steps found)
• streptorubin B biosynthesis (15/34 steps found)
• mycolate biosynthesis (16/205 steps found)
• superpathway of mycolate biosynthesis (17/239 steps found)

KEGG Metabolic Maps

• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.59, 4.2.1.60

Use Curated BLAST to search for 4.2.1.59 or 4.2.1.60 or 5.3.3.14

Protein Sequence (172 amino acids)

>IAI46_08860 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase (Serratia liquefaciens MT49)
MVEKRDSYTKEDLEASGRGELFGAGGPPLPAGNMLMMDRVVKMTEDGGTHNKGYVEAELD
INPDLWFFGCHFIGDPVMPGCLGLDAMWQLVGFYLGWLGGEGKGRALGVGEVKFTGQVLP
TAKKVTYRINFKRVIIRKLIMGVADGEVLVDGQVIYTASDLKVGLFKDTAAF