Protein Info for IAI46_08830 in Serratia liquefaciens MT49

Annotation: membrane integrity-associated transporter subunit PqiA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 transmembrane" amino acids 63 to 82 (20 residues), see Phobius details amino acids 110 to 134 (25 residues), see Phobius details amino acids 155 to 174 (20 residues), see Phobius details amino acids 179 to 199 (21 residues), see Phobius details amino acids 265 to 287 (23 residues), see Phobius details amino acids 315 to 339 (25 residues), see Phobius details amino acids 360 to 382 (23 residues), see Phobius details amino acids 390 to 412 (23 residues), see Phobius details TIGR00155: integral membrane protein, PqiA family" amino acids 15 to 421 (407 residues), 534.6 bits, see alignment E=8.5e-165 PF04403: PqiA" amino acids 61 to 211 (151 residues), 130.3 bits, see alignment E=2.9e-42 amino acids 264 to 422 (159 residues), 184 bits, see alignment E=8.7e-59

Best Hits

Swiss-Prot: 71% identical to PQIA_ECOLI: Intermembrane transport protein PqiA (pqiA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 92% identity to srr:SerAS9_1717)

Predicted SEED Role

"Paraquat-inducible protein A" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (435 amino acids)

>IAI46_08830 membrane integrity-associated transporter subunit PqiA (Serratia liquefaciens MT49)
MVCSHENHEQHSHATQQQDNLMLCPQCDMLVALPPLAYGSKAVCPRCKTTLSSRWQEPRK
RPIGYALSALFMLLLANIFPFINMRVAGLGNEIKLIQIPQVMVAEDYASMATLFMVFVQL
IPAFCMVAIIVLCARVRIPLGLKEWMAKMLFQFKTWCMVEIFLAGVLVSFVKLMAYGDIG
IGSSFVPYCLFCLLQVRAFQCVDRRWLWNDIEPAPRLDRPMQVGHIGLRQGLRSCQCCTA
ILPAEMTRCPRCHTKGYVRRRHSLQWTLALLVTSIMLYIPANLLPIMVTEALGNKITSTI
MAGVILLWGEGSYPVAMVIFIASIMVPSLKMLAIGWLCWDANGRHKPRADSERMHLIYEV
VEFVGRWSMIDVFVIAVLSALVRMGQLMSIYPATGALLFAMVVILTMFAAMTFDPRLTWD
RVNETIKKEPQGDGK