Protein Info for IAI46_08810 in Serratia liquefaciens MT49

Annotation: cell division protein ZapC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 PF21083: ZapC_N" amino acids 2 to 89 (88 residues), 133.1 bits, see alignment E=3.4e-43 PF07126: ZapC_C" amino acids 90 to 170 (81 residues), 94.9 bits, see alignment E=2.7e-31

Best Hits

Swiss-Prot: 72% identical to ZAPC_YERPE: Cell division protein ZapC (zapC) from Yersinia pestis

KEGG orthology group: None (inferred from 97% identity to spe:Spro_1741)

Predicted SEED Role

"FIG01055820: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (182 amino acids)

>IAI46_08810 cell division protein ZapC (Serratia liquefaciens MT49)
MKIKPDDNWRWYFDAEHDRLMLDLANGMIFRSRFPAKMLIPDAFDECSFCVDDAALYFNY
EEQCKQIKLSHEQRAELVLNALVAYRFLKPLMPKSWHFSQQHYPLQPKNGELAAVKVMES
GVEARLLVVEAGDNASLCLLAQNQLSVAGRTMVLGDAIKVMHDRLKPCAQDETSAPAYDR
AV