Protein Info for IAI46_08780 in Serratia liquefaciens MT49

Annotation: aliphatic sulfonates ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 PF00005: ABC_tran" amino acids 28 to 161 (134 residues), 109 bits, see alignment E=1.5e-35

Best Hits

Swiss-Prot: 86% identical to SSUB_YERPS: Aliphatic sulfonates import ATP-binding protein SsuB (ssuB) from Yersinia pseudotuberculosis serotype I (strain IP32953)

KEGG orthology group: None (inferred from 93% identity to srr:SerAS9_1707)

MetaCyc: 75% identical to aliphatic sulfonate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-56-RXN [EC: 7.6.2.14]

Predicted SEED Role

"Alkanesulfonates ABC transporter ATP-binding protein / Sulfonate ABC transporter, ATP-binding subunit SsuB" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (258 amino acids)

>IAI46_08780 aliphatic sulfonates ABC transporter ATP-binding protein (Serratia liquefaciens MT49)
MTTPARIPQGTPVTLESIAKRYGNRTVLDNIQLRISAGQFVAVVGRSGCGKSTLLRLMAG
LEKATSGALLSGNAPLASARDDTRLMFQDARLLPWKKVIDNVGLGLRGNWRADALQALEA
VGLADRANEWPAALSGGQKQRVALARALIHRPRLLLLDEPLGALDALTRIEMQGLIEGLW
QQHGFTVLLVTHDVSEAIALADRVILIEEGRIGLDLTVDLPRPRRKGSVKLAELEAEVLD
RVLSPPSPLSQATRRAAN