Protein Info for IAI46_08770 in Serratia liquefaciens MT49

Annotation: GGDEF domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 566 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 313 to 333 (21 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 399 to 557 (159 residues), 137.7 bits, see alignment E=1.6e-44 PF00990: GGDEF" amino acids 404 to 555 (152 residues), 134 bits, see alignment E=2.2e-43

Best Hits

KEGG orthology group: None (inferred from 85% identity to spe:Spro_1733)

Predicted SEED Role

"diguanylate cyclase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (566 amino acids)

>IAI46_08770 GGDEF domain-containing protein (Serratia liquefaciens MT49)
MKVKYLIYFFTFALMSSFALFISDELSEADTEYRDNQLNLYKITRAKEISEAFQATLLAH
RLKRLSLIDPRITPHQWQDADRVAREKIAHFRPHIDSEISQRLGIRQKIAALSMLSLMEQ
LLNNDNLQLSQVTEANANLFNINSAYYISQASKSYYRYSYDNRMVDGDSFMFLEAVRLNN
RLNMSVTELIDQIIDVNTNRLARKDAYLKAIQLTGVLNALSTRLIFMKLTYNDVKTTALV
NEILGQLSAQQIKIITEGLYTAVNTHTAYPTDAIYPYVKNLSELSQRLYQRSFEMETAAS
QSKIYDSQTAIDGMISLAGLIALFIFLPTLVYCSNISRWLTKTHNNILRLSHGDMNIARN
EVFYGQELIAISDAIKQLKQYQLEKVTLENEKHLLIKELEASSYLDPLTNIYNRRKFFLE
CESLAAGSYPLAFCLIDIDNFKSLNDTYGHHVGDLVLVAFGKLLQSTFRSSDIFCRYGGE
EFAVILGNCTLENAQEVMSKLRERTHQFSLTLTDGQNVRFTTCCGIAQVRDIRLLPAAIK
QADEALYFCKKNGKDQIGIHTQNGFI