Protein Info for IAI46_08700 in Serratia liquefaciens MT49

Annotation: 3-deoxy-manno-octulosonate cytidylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 TIGR00466: 3-deoxy-D-manno-octulosonate cytidylyltransferase" amino acids 1 to 241 (241 residues), 415.5 bits, see alignment E=3e-129 PF02348: CTP_transf_3" amino acids 4 to 221 (218 residues), 255.4 bits, see alignment E=5.1e-80 PF12804: NTP_transf_3" amino acids 19 to 126 (108 residues), 46.4 bits, see alignment E=4.9e-16

Best Hits

Swiss-Prot: 98% identical to KDSB_SERP5: 3-deoxy-manno-octulosonate cytidylyltransferase (kdsB) from Serratia proteamaculans (strain 568)

KEGG orthology group: K00979, 3-deoxy-manno-octulosonate cytidylyltransferase (CMP-KDO synthetase) [EC: 2.7.7.38] (inferred from 98% identity to spe:Spro_1719)

MetaCyc: 77% identical to 3-deoxy-manno-octulosonate cytidylyltransferase (Escherichia coli K-12 substr. MG1655)
3-deoxy-manno-octulosonate cytidylyltransferase. [EC: 2.7.7.38]

Predicted SEED Role

"3-deoxy-manno-octulosonate cytidylyltransferase (EC 2.7.7.38)" in subsystem KDO2-Lipid A biosynthesis (EC 2.7.7.38)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.38

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (249 amino acids)

>IAI46_08700 3-deoxy-manno-octulosonate cytidylyltransferase (Serratia liquefaciens MT49)
MSFVAIIPARYASTRLPGKPLADIHGKPMVVHVMERARESGASRVIVATDHPAVAEAVKA
AGGEVCMTRADHNSGTERLAEVIEHYGFNDDEIIVNVQGDEPLIPPVIVRQVAENLAGSQ
AGMATLAVPIDSAEEAFNPNAVKVVMDAQGYALYFSRATIPWDRERFAQSKESIGDSLLR
HIGIYAYRAGFVRRYVTWAPSQLEQIELLEQLRVLWYGEKIHVAVAKAMPSVGVDTPEDL
QRVRDSMKS