Protein Info for IAI46_08670 in Serratia liquefaciens MT49

Annotation: tetraacyldisaccharide 4'-kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02606: LpxK
  • amino acids 14 to 320 (307 residues), 412.9 bits, E=4.7e-128
• TIGR00682: tetraacyldisaccharide 4'-kinase
  • amino acids 19 to 325 (307 residues), 374.7 bits, E=1.8e-116

Best Hits

Swiss-Prot: 94% identical to LPXK_SERP5: Tetraacyldisaccharide 4'-kinase (lpxK) from Serratia proteamaculans (strain 568)

KEGG orthology group: K00912, tetraacyldisaccharide 4'-kinase [EC: 2.7.1.130] (inferred from 94% identity to spe:Spro_1713)

MetaCyc: 70% identical to tetraacyldisaccharide 4'-kinase (Escherichia coli K-12 substr. MG1655)
Tetraacyldisaccharide 4'-kinase. [EC: 2.7.1.130]

Predicted SEED Role

"Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130)" in subsystem KDO2-Lipid A biosynthesis or Lipopolysaccharide-related cluster in Alphaproteobacteria (EC 2.7.1.130)

MetaCyc Pathways

• superpathway of (Kdo)₂-lipid A biosynthesis (17/17 steps found)
• lipid IV_A biosynthesis (P. gingivalis) (9/9 steps found)
• lipid IV_A biosynthesis (E. coli) (6/6 steps found)
• lipid IV_A biosynthesis (H. pylori) (6/6 steps found)
• lipid IV_A biosynthesis (P. putida) (6/6 steps found)
• lipid IV_A biosynthesis (Vibrio cholerae serogroup O1 El Tor) (6/6 steps found)
• lipid IV_A biosynthesis (generic) (6/6 steps found)
• lipid IV_A biosynthesis (2,3-diamino-2,3-dideoxy-D-glucopyranose-containing) (5/6 steps found)
• superpathway of Kdo₂-lipid A biosynthesis (18/25 steps found)

KEGG Metabolic Maps

• Lipopolysaccharide biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.130

Protein Sequence (326 amino acids)

>IAI46_08670 tetraacyldisaccharide 4'-kinase (Serratia liquefaciens MT49)
MIERIWSGSSLVYLLLLPLSWLYGLVSGLIRLSYRCGLRKSWRAPVPVVVVGNLTAGGNG
KTPMVIWLVEQLQQRGYRVGVVSRGYGGKAEAYPLLLNASTTTRQAGDEPVLIYQRTAAP
VAISPNRAEAVQALLKQHRLDVVITDDGLQHYALQRDFELVVIDGVRRFGNGWWLPAGPM
RERVSRLNSVDALITNGGVAQPGEIAMRLQAREAVNVATGERRPAVELPHVVAMAGIGHP
PRFFATLEKLGVDVEREVAFADHQEYQHDPLAALVTPGQTLLMTEKDAVKCRAFAQPNWW
YLPVDAVLPSEQAEQLLQNIEALLKQ