Protein Info for IAI46_08600 in Serratia liquefaciens MT49

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 41 to 62 (22 residues), see Phobius details amino acids 74 to 92 (19 residues), see Phobius details amino acids 100 to 120 (21 residues), see Phobius details amino acids 132 to 154 (23 residues), see Phobius details amino acids 160 to 180 (21 residues), see Phobius details amino acids 203 to 224 (22 residues), see Phobius details amino acids 237 to 254 (18 residues), see Phobius details amino acids 265 to 283 (19 residues), see Phobius details amino acids 289 to 309 (21 residues), see Phobius details amino acids 323 to 344 (22 residues), see Phobius details amino acids 350 to 368 (19 residues), see Phobius details PF07690: MFS_1" amino acids 11 to 337 (327 residues), 111.3 bits, see alignment E=1e-35 PF06779: MFS_4" amino acids 28 to 367 (340 residues), 48.7 bits, see alignment E=1.5e-16 PF00083: Sugar_tr" amino acids 38 to 176 (139 residues), 33.2 bits, see alignment E=5.8e-12 PF12832: MFS_1_like" amino acids 186 to 354 (169 residues), 30.6 bits, see alignment E=3.9e-11

Best Hits

Swiss-Prot: 80% identical to Y2315_YERPP: Uncharacterized MFS-type transporter YPDSF_2315 (YPDSF_2315) from Yersinia pestis (strain Pestoides F)

KEGG orthology group: None (inferred from 96% identity to srr:SerAS9_1671)

Predicted SEED Role

"Hypothetical MFS-type transporter protein YcaD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (381 amino acids)

>IAI46_08600 MFS transporter (Serratia liquefaciens MT49)
MSAYSRPVLLLLCGLLLLTVSIAVLNTLVPLWLTHAQLSTWQVGMVSSSYFTGNLVGTLI
AGKLIQRIGFTRSYHLACVVFAVATAGMALSLDFWSWMGWRFFAGIGCAWIWVIVESALL
RSGNLSNRGQLLAAYMMVYYLGTVVGQLLLSMVSTELLNVVPWVTAIVLSATLPMLFARV
NSRHDEPQQAAVWPMLKRRSARLGINGCVISGIVLGSLYGLMPLYLSHQGMSDANVGYWM
ALLVSSGIVGQWPVGRLADRYGRLLVLRIQVFVVILASIAMLGNYAMAPALFILGCAGFT
LYPVAMSWACEKALPHELVAMNQALLMSYTIGSLLGPSMTALLMQNYSDRLLFVMIAAVA
LVYLMMLLRKPDRHHTPLAAA