Protein Info for IAI46_08590 in Serratia liquefaciens MT49

Annotation: dimethyl sulfoxide reductase anchor subunit family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 48 to 68 (21 residues), see Phobius details amino acids 88 to 107 (20 residues), see Phobius details amino acids 117 to 136 (20 residues), see Phobius details amino acids 151 to 171 (21 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details amino acids 223 to 245 (23 residues), see Phobius details amino acids 253 to 276 (24 residues), see Phobius details PF04976: DmsC" amino acids 1 to 276 (276 residues), 345.9 bits, see alignment E=8.7e-108

Best Hits

Swiss-Prot: 62% identical to YNFH_ECOLI: Anaerobic dimethyl sulfoxide reductase chain YnfH (ynfH) from Escherichia coli (strain K12)

KEGG orthology group: K07312, Tat-targeted selenate reductase subunit YnfH (inferred from 86% identity to spe:Spro_1689)

MetaCyc: 62% identical to putative menaquinol dehydrogenase (Escherichia coli K-12 substr. MG1655)
Selenate reductase. [EC: 1.97.1.9]

Predicted SEED Role

"Anaerobic dimethyl sulfoxide reductase chain C (EC 1.8.5.3)" (EC 1.8.5.3)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.8.5.3

Use Curated BLAST to search for 1.8.5.3 or 1.97.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (286 amino acids)

>IAI46_08590 dimethyl sulfoxide reductase anchor subunit family protein (Serratia liquefaciens MT49)
MGMGWQEWPLMLFTVLGQCVVGGVIVMGLAIIGGNLNEQQRRAVHRAMFFLWLLMGIAFI
ASTLHLGSPWRAFNSLNRIGASALSNEIAAGALFFAVGGCYWLLAVLGKIPPLLGRVWLW
VTMVLGLVFVYMMTRVYQIDTVPTWHNGYTTLSFFLTVPIGGPMLGVLLLRFAGLDVTTR
HSLATLSVVALLVSLGTVMMQGYELASISSSVQQASALIPQYGQLMVGRLVLVVLGLGCW
ICPLLRRGNASVMGMALGLILVIAGELVGRGVFYGLHMTVGMAVAG