Protein Info for IAI46_08585 in Serratia liquefaciens MT49

Annotation: dimethylsulfoxide reductase subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02951: dimethylsulfoxide reductase, chain B
  • amino acids 4 to 163 (160 residues), 262.5 bits, E=7.2e-83
• PF12797: Fer4_2
  • amino acids 7 to 25 (19 residues), 25.1 bits, see alignment (E = 4.9e-09)
  • amino acids 91 to 111 (21 residues), 25.5 bits, see alignment (E = 3.6e-09)
• PF12800: Fer4_4
  • amino acids 12 to 25 (14 residues), 15.2 bits, see alignment (E = 9.5e-06)
  • amino acids 97 to 112 (16 residues), 15.4 bits, see alignment (E = 7.7e-06)
• PF13247: Fer4_11
  • amino acids 59 to 153 (95 residues), 98.3 bits, E=1e-31
• PF12837: Fer4_6
  • amino acids 91 to 114 (24 residues), 30.1 bits, see alignment (E = 1.3e-10)
• PF00037: Fer4
  • amino acids 92 to 114 (23 residues), 30.2 bits, see alignment (E = 1.2e-10)

Best Hits

Swiss-Prot: 86% identical to DMSB_ECOLI: Anaerobic dimethyl sulfoxide reductase chain B (dmsB) from Escherichia coli (strain K12)

KEGG orthology group: K07307, anaerobic dimethyl sulfoxide reductase subunit B (DMSO reductase iron- sulfur subunit) (inferred from 93% identity to spe:Spro_1688)

MetaCyc: 86% identical to dimethyl sulfoxide reductase subunit B (Escherichia coli K-12 substr. MG1655)
DIMESULFREDUCT-RXN [EC: 1.8.5.3]

Predicted SEED Role

"Anaerobic dimethyl sulfoxide reductase chain B (EC 1.8.5.3)" (EC 1.8.5.3)

MetaCyc Pathways

• NADH to dimethyl sulfoxide electron transfer (2/2 steps found)
• formate to dimethyl sulfoxide electron transfer (2/2 steps found)
• hydrogen to dimethyl sulfoxide electron transfer (1/2 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.8.5.3

Use Curated BLAST to search for 1.8.5.3

Protein Sequence (205 amino acids)

>IAI46_08585 dimethylsulfoxide reductase subunit B (Serratia liquefaciens MT49)
MTQQYGFFIDSSRCTGCKTCELACKDYKNLTPDVSFRRIYEYAGGDWFQDGDGWQQNVFA
YYLSIACNHCEDPACTKVCPTGAMHKREDGFVVVNEEVCIGCRYCHMACPYGAPQYNSTK
GHMTKCDGCYKRVAEGHKPICVESCPLRALDFGPIEQLRQQHGSLAQVAPLPAAHFTRPC
LVVKPNANSRPSGDTTGYLANPKEV