Protein Info for IAI46_08565 in Serratia liquefaciens MT49

Annotation: outer membrane lipoprotein chaperone LolA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00547: outer membrane lipoprotein carrier protein LolA
  • amino acids 1 to 203 (203 residues), 336.5 bits, E=2.4e-105
• PF03548: LolA
  • amino acids 33 to 191 (159 residues), 200 bits, E=2.2e-63

Best Hits

Swiss-Prot: 97% identical to LOLA_SERP5: Outer-membrane lipoprotein carrier protein (lolA) from Serratia proteamaculans (strain 568)

KEGG orthology group: K03634, outer membrane lipoprotein carrier protein (inferred from 97% identity to spe:Spro_1684)

MetaCyc: 73% identical to outer membrane lipoprotein carrier protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Outer membrane lipoprotein carrier protein LolA"

Protein Sequence (203 amino acids)

>IAI46_08565 outer membrane lipoprotein chaperone LolA (Serratia liquefaciens MT49)
MKKLLVACCLLSGFASTSVLADAAQDLQSRLAKVNSFHASFAQTVTSSDGAAVQQGEGEL
WVKRPNLFNWHMTSPDESVLVSDGQTLWFYNPFVEQVTATWLKNATGNTPFMLITRNNAN
DWKQYNVKQKGDDFELTPKSSSGNLKQFAITVTNSGTIRSFAAVEQDGQRSSYALKSQQN
VAADASKFKFTPPKGVTLDDQRQ