Protein Info for IAI46_08520 in Serratia liquefaciens MT49

Annotation: translation initiation factor IF-1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 72 TIGR00008: translation initiation factor IF-1" amino acids 3 to 71 (69 residues), 128.8 bits, see alignment E=2.9e-42 PF01176: eIF-1a" amino acids 7 to 70 (64 residues), 98.6 bits, see alignment E=6.5e-33

Best Hits

Swiss-Prot: 100% identical to IF1_YERPN: Translation initiation factor IF-1 (infA) from Yersinia pestis bv. Antiqua (strain Nepal516)

KEGG orthology group: K02518, translation initiation factor IF-1 (inferred from 100% identity to ddd:Dda3937_02362)

Predicted SEED Role

"Translation initiation factor 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (72 amino acids)

>IAI46_08520 translation initiation factor IF-1 (Serratia liquefaciens MT49)
MAKEDNIEMQGTVLDTLPNTMFRVELENGHVVTAHISGKMRKNYIRILTGDKVTVELTPY
DLSKGRIVFRSR