Protein Info for IAI46_08470 in Serratia liquefaciens MT49

Annotation: NADH oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 PF00970: FAD_binding_6" amino acids 37 to 104 (68 residues), 27.2 bits, see alignment E=6.2e-10 PF00175: NAD_binding_1" amino acids 116 to 218 (103 residues), 53.6 bits, see alignment E=4.9e-18 PF00111: Fer2" amino acids 261 to 327 (67 residues), 56.1 bits, see alignment E=4.3e-19

Best Hits

Swiss-Prot: 58% identical to HCR_ECOLI: NADH oxidoreductase HCR (hcr) from Escherichia coli (strain K12)

KEGG orthology group: K11933, NADH oxidoreductase Hcr [EC: 1.-.-.-] (inferred from 91% identity to spe:Spro_1665)

MetaCyc: 58% identical to NADH oxidoreductase (Escherichia coli K-12 substr. MG1655)
1.6.-.-

Predicted SEED Role

"NADH oxidoreductase hcr (EC 1.-.-.-)" in subsystem Nitrosative stress (EC 1.-.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (334 amino acids)

>IAI46_08470 NADH oxidoreductase (Serratia liquefaciens MT49)
MTQPSPLCPNRMQVHSIRQETADVWTLNLICDVFYPYQAGQFALVSIRNSEETLRAYTLS
SSPGQSRFLSISVRCLPDGIGSRWLTREVKPGNTLWLSDAQGEFSCEQHPANSYLMLAAG
CGVTPIISMCRWLVANRPTCDVAVIFNVRTPADTIFAEQWRELCAAHPQLRLTLVAEQDI
QPGYLSGRISAEVLRQVAPDITERRVMTCGPAPYMTQAEQLCLQLGVPASRFHKEQFHTP
AETDSGQGATLMLRSARPLGEYHVPVGSTLLAAMEANALPVNAACRAGVCGSCKTRILEG
DYTTTSSMTLTPAEIAQGYVLACSCQLQGDVTLA